PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.337320.1
Common NameCsa_3G816030, mybys
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 295aa    MW: 32662.6 Da    PI: 6.5306
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.337320.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W++++   g+ R+ k+c++rw +yl
   Cucsa.337320.1 14 KGPWTPEEDIILVSYIQQHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding461.2e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   Cucsa.337320.1  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.003965IPR017930Myb domain
SuperFamilySSF466899.17E-3111108IPR009057Homeodomain-like
SMARTSM007172.5E-141363IPR001005SANT/Myb domain
PfamPF002493.1E-161461IPR001005SANT/Myb domain
CDDcd001672.06E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.9E-2565117IPR009057Homeodomain-like
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.7566116IPR017930Myb domain
PfamPF002494.8E-1367112IPR001005SANT/Myb domain
CDDcd001677.89E-969111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRPPCCEKV GIKKGPWTPE EDIILVSYIQ QHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLN  120
SAAVDTPEPP ESATTRFQSN DKVPTADSPS SLVSNRATTY ASSAENISRL LQAWMRSSPE  180
ESRRKMSGEN SIAAATQQQQ QPKAEPDGGE LVSGEEFDSI LSFENMKSVN SWGKSSLSYK  240
GKEEVNVGEK QSSENDDATA ENATAPPLSF LEKWLFEEGA AGQVEEMMEL SPVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3116720.0DQ311672.1 Cucumis sativus MYB transcription factor (mybys) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267555.10.0myb-related protein 306-like
SwissprotP813921e-85MYB06_ANTMA; Myb-related protein 306
TrEMBLQ0ZPA20.0Q0ZPA2_CUCSA; MYB transcription factor
STRINGPOPTR_0013s06390.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82033145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-100myb domain protein 60
Publications ? help Back to Top
  1. Tzfira T, et al.
    pSAT vectors: a modular series of plasmids for autofluorescent protein tagging and expression of multiple genes in plants.
    Plant Mol. Biol., 2005. 57(4): p. 503-16
    [PMID:15821977]
  2. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  3. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]